PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00069.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 1115aa    MW: 119211 Da    PI: 8.1679
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00069.1.g00070.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.51.8e-05779819440
                      zf-B_box   4 rkCpeHeekelqlfCedCqq.llCedCllee.Hkg..Htvv 40 
                                   r+C ++   ++  +C++C+  +lC++C     H g  H++v
  Zjn_sc00069.1.g00070.1.am.mk 779 RRCGLCMAAPAAVHCRSCGGvFLCASCDARPaHAGagHERV 819
                                   79****************876********999987889875 PP

2zf-B_box23.61.1e-07819864342
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                    ++C+ +e  ++   C+ +   lC+ C   +H+       H+++p+
  Zjn_sc00069.1.g00070.1.am.mk 819 VWVCEVCETAPADVMCKADAAVLCAACDADIHEAnplagrHRRDPI 864
                                   689*****************************77899999998876 PP

3CCT68.51.7e-2310371080144
                           CCT    1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44  
                                    Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Zjn_sc00069.1.g00070.1.am.mk 1037 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 1080
                                    9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF522833.61E-30113240No hitNo description
Gene3DG3DSA:3.40.50.7205.6E-37113238IPR016040NAD(P)-binding domain
PfamPF003899.9E-33116306IPR006139D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
SuperFamilySSF517352.02E-6238308IPR016040NAD(P)-binding domain
Gene3DG3DSA:3.40.50.7201.7E-11240296IPR016040NAD(P)-binding domain
PfamPF028265.8E-7240274IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain
Gene3DG3DSA:3.30.1330.901.6E-19311458IPR029009Allosteric substrate binding domain
SuperFamilySSF1435489.15E-22312458IPR029009Allosteric substrate binding domain
SuperFamilySSF550213.88E-12454527No hitNo description
Gene3DG3DSA:3.30.70.2605.3E-14459526No hitNo description
PROSITE profilePS5167111.434464539IPR002912ACT domain
CDDcd049023.35E-20464529No hitNo description
PfamPF018426.8E-9465522IPR002912ACT domain
SMARTSM003360.045776821IPR000315B-box-type zinc finger
CDDcd000212.97E-4779821No hitNo description
PROSITE profilePS5011910.224817864IPR000315B-box-type zinc finger
PfamPF006435.2E-6818864IPR000315B-box-type zinc finger
CDDcd000214.02E-7820864No hitNo description
SMARTSM003365.8E-7822864IPR000315B-box-type zinc finger
PfamPF062032.7E-1710371079IPR010402CCT domain
PROSITE profilePS5101716.89610371079IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0016597Molecular Functionamino acid binding
GO:0016616Molecular Functionoxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0051287Molecular FunctionNAD binding
Sequence ? help Back to Top
Protein Sequence    Length: 1115 aa     Download sequence    Send to blast
MTKWREMQHA RARRCRTGGG RRTASRTQRA SDSTSPLVNH TLLDCAKPMA LATPLRLILP  60
VAAAPAMPPD PAGPSFRALP PRRCHLRGSL AAAPSPSPAA RTVAASAAAG AGRPTVLVTE  120
KLGSAGLDLL REFANVDCSY ELTTEELRAK VSLVDALVVR SATRVSREVF EAARGRLRVV  180
GRAGVGIDNV DLQAATEVGC LVVNAPTANT VAAAEHAVAL IAAMARNVAQ ADASLKAGTK  240
ACTTAALDVF TEEPPAKDSK LVHHENVTVT PHLGASTTEA QEGVAVEIAE AVIGALRGDL  300
AATAVNAPMV PAEVLSELSP YIILAEKLGR LVVQLVAGGS GIKGVKVVYS SARDPDDLDT  360
RILRAMVIKG IIEPISSAFI NIVNADYVAK QRGLQIVEER ILLDGSQEVP LDSIQVHLAN  420
VESKFAGALS DAGDIRVEGQ VKNGTPHLTF VGSFDVDVSL EGNLLLFRQV DQPGIIGKVG  480
SVLGKMNVNV NFMSVGRTAR GKEAIMAIGV DEELEKEALK LIGFLDAELE TSVLRRLGFI  540
PKSIDQKGPS PTNLAKSLTK SSGKFGVGMN CRKIRRRFRV MAARDVKSFR VLNAAITPTT  600
TPQIRWALRN SKPLWGAPHD MAPAADRQPH EMTASGSSPG TAVNDASAPV ACRGSTRPRW  660
PITVCDYPFI HAKGQPRLVH DADIFLPPPL VRGAHLFTCT NRFPTTCASP ATSPSRTYHY  720
MYRASFHYAP PPPSASLPFP LVLAGANRAE LLATIAKRDR TAPPVTMMEL HKYWGLGGRR  780
CGLCMAAPAA VHCRSCGGVF LCASCDARPA HAGAGHERVW VCEVCETAPA DVMCKADAAV  840
LCAACDADIH EANPLAGRHR RDPIAPIGSA AADSMLFGGA AEEEQKETEH EQHSLNLNVE  900
AKDMKLDYLF SDLDPYLNVE LPRFHHADSV VPSGVAVELD FTGGIGVKQP SYSSYTATSL  960
APSGSSSEVS VVPDALYVGG GHGSFELDFT RPKHQAYIPY TANPPSHSVA SVDAAELVPD  1020
QRGEAFAVPR PVSDEGREAR LMRYREKRKN RRFEKTIRYA SRKAYAETRP RIKGRFAKRT  1080
DTDTDADDAE AEAEADVPKP SSYMLDFGYS VVPSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2g76_A1e-1914223856151D-3-phosphoglycerate dehydrogenase
2g76_B1e-1914223856151D-3-phosphoglycerate dehydrogenase
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-43CONSTANS-like 5